Micron Document




Emmanuelle Charpentier
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
top
Emmanuelle Marie Charpentier (French pronunciation: [emanɥɛl maʁi ʃaʁpɑ̃tje]; born 11 December 1968cite-ref-2[2]) is a French professor and researcher in microbiology, genetics, and biochemistry.cite-ref-abbott2016-1-1[1] As of 2015, she has been a director at the Max Planck Institute for Infection Biology in Berlin. In 2018, she founded an independent research institute, the Max Planck Unit for the Science of Pathogens.cite-ref-3[3] In 2020, Charpentier and American biochemist Jennifer Doudna of the University of California, Berkeley, were awarded the Nobel Prize in Chemistry "for the development of a method for genome editing" (through CRISPR). This was the first science Nobel Prize ever won by two women only.cite-ref-01-4-0[4]cite-ref-nyt-20201007-5-0[5]cite-ref-auto-6-0[6]

Contents

Awards

──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────

Early life and education

Charpentier's paternal grandfather, surnamed Sinanian, was an Armenian who escaped to France during the Armenian Genocide and met his wife in Marseille.cite-ref-public-radio-of-armenia-7-0[7] She was born in 1968 in Juvisy-sur-Orge in France and studied biochemistry, microbiology, and genetics at the Pierre and Marie Curie University (which became the Faculty of Science of Sorbonne University) in Paris.cite-ref-mpg-vita-8-0[8] She was a graduate student at the Institut Pasteur from 1992 to 1995 and was awarded a research doctorate. Charpentier's PhD work investigated molecular mechanisms involved in antibiotic resistance.cite-ref-9[9]

Career and research

Charpentier worked as a university teaching assistant at Pierre and Marie Curie University from 1993 to 1995 and as a postdoctoral fellow at the Institut Pasteur from 1995 to 1996. She moved to the US and worked as a postdoctoral fellow at Rockefeller University in New York from 1996 to 1997. During this time, Charpentier worked in the lab of microbiologist Elaine Tuomanen.cite-ref-abbott-432-10-0[10] Tuomanen's lab investigated how the pathogen Streptococcus pneumoniae utilizes mobile genetic elements to alter its genome. Charpentier also helped to demonstrate how S. pneumoniae develops vancomycin resistance.cite-ref-11[11]

Charpentier was an assistant research scientist at the New York University Medical Center from 1997 to 1999. She worked in the lab of Pamela Cowin, a skin-cell biologist interested in mammalian gene manipulation. Charpentier published a paper exploring the regulation of hair growth in mice.cite-ref-12[12] She held the position of Research Associate at the St. Jude Children's Research Hospital and at the Skirball Institute of Biomolecular Medicinecite-ref-13[13] in New York from 1999 to 2002.cite-ref-mpg-vita-8-1[8]

After five years in the United States, Charpentier returned to Europe and became the lab head and a guest professor at the Institute of Microbiology and Genetics, University of Vienna, from 2002 to 2004. In 2004, Charpentier published her discovery of an RNA molecule involved in the regulation of virulence-factor synthesis in Streptococcus pyogenes.cite-ref-14[14] From 2004 to 2006 she was lab head and an assistant professor at the Department of Microbiology and Immunobiology. In 2006 she became a privatdozentin (Microbiology) and received her habilitation at the Centre of Molecular Biology. From 2006 to 2009 she worked as lab head and associate professor at the Max F. Perutz Laboratories.cite-ref-mpg-vita-8-2[8]

Charpentier moved to Sweden and became lab head and associate professor at the Laboratory for Molecular Infection Medicine Sweden (MIMS), at Umeå University. She held the position of group leader from 2008 to 2013 and was visiting professor from 2014 to 2017.cite-ref-mims-15-0[15] She moved to Germany to act as department head and W3 Professor at the Helmholtz Centre for Infection Researchcite-ref-16[16] in Braunschweig and the Hannover Medical School from 2013 until 2015. In 2014 she became an Alexander von Humboldt Professor.cite-ref-mpg-vita-8-3[8]

In 2015 Charpentier accepted an offer from the German Max Planck Society to become a scientific member of the society and a director at the Max Planck Institute for Infection Biology in Berlin. Since 2016, she has been an Honorary Professor at Humboldt University in Berlin; since 2018, she is the Founding and acting director of the Max Planck Unit for the Science of Pathogens.cite-ref-mpg-vita-8-4[8]cite-ref-17[17]cite-ref-18[18] Charpentier retained her position as visiting professor at Umeå University until the end of 2017 when a new donation from the Kempe Foundations and the Knut and Alice Wallenberg Foundation allowed her to offer more young researchers positions within research groups of the MIMS Laboratory.cite-ref-19[19]

CRISPR/Cas9

Charpentier is best known for her Nobel-winning work of deciphering the molecular mechanisms of a bacterial immune system, called CRISPR/Cas9, and repurposing it into a tool for genome editing. In particular, she uncovered a novel mechanism for the maturation of a non-coding RNA which is pivotal in the function of CRISPR/Cas9. Specifically, Charpentier demonstrated that a small RNA called tracrRNA is essential for the maturation of crRNA.cite-ref-nature-20-0[20]

In 2011, Charpentier met Jennifer Doudna at a research conference in San Juan, Puerto Rico, and they began a collaboration.cite-ref-abbott-432-10-1[10] Working with Doudna's laboratory, Charpentier's laboratory showed that Cas9 could be used to make cuts in any DNA sequence desired.cite-ref-21[21]cite-ref-science-22-0[22] The method they developed involved the combination of Cas9 with easily created synthetic "guide RNA" molecules. Synthetic guide RNA is a chimera of crRNA and tracrRNA; therefore, this discovery demonstrated that the CRISPR-Cas9 technology could be used to edit the genome with relative ease.cite-ref-science-22-1[22] Researchers worldwide have employed this method successfully to edit the DNA sequences of plants, animals, and laboratory cell lines. Since its discovery, CRISPR has revolutionized genetics by allowing scientists to edit genes to probe their role in health and disease and to develop genetic therapies with the hope that it will prove safer and more effective than the first generation of gene therapies.cite-ref-auto-6-1[6]

In 2013, Charpentier co-founded CRISPR Therapeutics and ERS Genomics along with Shaun Foy and Rodger Novak.cite-ref-23[23]

Awards

In 2015, Time magazine designated Charpentier one of the Time 100 most influential people in the world (together with Jennifer Doudna).cite-ref-24[24]cite-ref-25[25]

Charpentier's awards are:

Nobel Prize in Chemistry,cite-ref-26[26] the Breakthrough Prize in Life Sciences, the Louis-Jeantet Prize for Medicine, the Gruber Foundation International Prize in Genetics, the Leibniz Prize, the Tang Prize, the Japan Prize, and the Kavli Prize in Nanoscience. She has won the BBVA Foundation Frontiers of Knowledge Award jointly with Jennifer Doudna and Francisco Mojica.cite-ref-27[27]

• 2009 – Theodor Körner Prize for Science and Culturecite-ref-28[28]
• 2011 – The Fernström Prize for young and promising scientistscite-ref-29[29]
• 2014 – Alexander von Humboldt Professorshipcite-ref-30[30]
• 2014 – The Göran Gustafsson Prize for Molecular Biology (Royal Swedish Academy of Sciences)cite-ref-31[31]
• 2014 – The Jacob Heskel Gabbay Awardcite-ref-33[33] (shared with Feng Zhang and Jennifer Doudna)
• 2015 – Time 100: Pioneerscite-ref-34[34] (shared with Jennifer Doudna)
• 2015 – The Breakthrough Prize in Life Sciencescite-ref-35[35] (shared with Jennifer Doudna)
• 2015 – Louis-Jeantet Prize for Medicinecite-ref-36[36]
• 2015 – The Ernst Jung Prize in Medicinecite-ref-37[37]
• 2015 – Princess of Asturias Awards (shared with Jennifer Doudna)cite-ref-38[38]
• 2015 – Gruber Foundation International Prize in Genetics (shared with Jennifer Doudna)cite-ref-39[39]
• 2015 – Carus Medal, from German National Academy of Science, Leopoldinacite-ref-40[40]
• 2015 – Massry Prizecite-ref-41[41]
• 2015 – Hansen Family Awardcite-ref-42[42]
• 2016 – Otto Warburg Medalcite-ref-43[43]
• 2016 – Leibniz Prize from the German Research Foundationcite-ref-leibnizprize2016-45-0[45]
• 2016 – Canada Gairdner International Award (shared with Jennifer Doudna and Feng Zhang)cite-ref-46[46]
• 2016 – Paul Ehrlich and Ludwig Darmstaedter Prize (jointly with Jennifer Doudna)cite-ref-47[47]
• 2016 – Tang Prize (shared with Jennifer Doudna and Feng Zhang)cite-ref-48[48]
• 2016 – HFSP Nakasone Award (jointly with Jennifer Doudna)cite-ref-49[49]
• 2016 – Knight (Chevalier) French National Order of the Legion of Honourcite-ref-50[50]
• 2016 – Meyenburg Prizecite-ref-51[51]
• 2016 – Wilhelm Exner Medalcite-ref-52[52]
• 2016 – John Scott Awardcite-ref-53[53]
• 2017 – BBVA Foundation Frontiers of Knowledge Award (jointly with Jennifer Doudna and Francisco Mojica)cite-ref-54[54]
• 2017 – Japan Prize (jointly with Jennifer Doudna)cite-ref-55[55]
• 2017 – Albany Medical Center Prize (jointly with Jennifer Doudna, Luciano Marraffini, Francisco Mojica, and Feng Zhang)cite-ref-56[56]
• 2017 – Pour le Méritecite-ref-57[57]
• 2018 – Kavli Prize in Nanoscience (jointly with Jennifer Doudna and Virginijus Šikšnys)cite-ref-www-kavliprize-org-2018-58-0[58]
• 2018 – Bijvoet Medal of the Bijvoet Center for Biomolecular Research of Utrecht Universitycite-ref-60[60]
• 2018 – Harvey Prize (jointly with Jennifer Doudna and Feng Zhang)cite-ref-61[61]
• 2019 – Scheele Award of the Swedish Pharmaceutical Societycite-ref-62[62]
• 2019 – Knight Commander's Cross of the Order of Merit of the Federal Republic of Germanycite-ref-der-bundespr-sident-63-0[63]
• 2020 – Wolf Prize in Medicine (jointly with Jennifer Doudna)cite-ref-64[64]
• 2020 – Nobel Prize in Chemistry (jointly with Jennifer Doudna)cite-ref-01-4-1[4]
• 2023 - National Inventors Hall of Fame (jointly with Jennifer Doudna)
• 2024 – Golden Plate Award of the American Academy of Achievementcite-ref-65[65]

Honorary doctorate degrees

• 2016 – École Polytechnique Fédérale de Lausannecite-ref-bourquenoud-2016-g938-66-0[66]
• 2016 – KU, (Catholic University) Leuven, Belgiumcite-ref-67[67]
• 2016 – New York University (NYU)cite-ref-68[68]
• 2017 – Faculty of Medicine, Umeå University, Swedencite-ref-69[69]
• 2017 – University of Western Ontario, London, Canadacite-ref-70[70]
• 2018 – Université catholique de Louvain, Belgiumcite-ref-72[72]
• 2018 – University of Cambridgecite-ref-73[73]
• 2018 – University of Manchestercite-ref-74[74]
• 2019 – McGill University, Canadacite-ref-75[75]
• 2024 – University of Saskatchewan, Canada
• 2024 – University of Perugia, Perugia, Italycite-ref-76[76]

Memberships

• 2014 – European Molecular Biology Organisationcite-ref-find-people-in-the-embo-communities-w845-77-0[77]cite-ref-nachrichten-aus-der-wissenschaft-idw-2014-k381-78-0[78]
• 2016 – Austrian Academy of Sciencescite-ref-81[81]
• 2016 – Royal Swedish Academy of Sciencescite-ref-82[82]
• 2017 – U.S. National Academy of Sciences, Foreign Associatecite-ref-83[83]
• 2017 – French Académie des sciencescite-ref-85[85]
• 2018 – European Academy of Sciences and Artscite-ref-european-academy-of-sciences-and-arts-86-0[86]
• 2021 – Pontifical Academy of Sciencescite-ref-87[87]
• 2024 – Foreign Member of the Royal Societycite-ref-88[88]

In popular culture

In 2019, Charpentier was a featured character in the play STEM FEMMES by Philadelphia theater company Applied Mechanics.cite-ref-89[89]

In 2021, Walter Isaacson detailed the story of Jennifer Doudna and her collaboration with Charpentier leading to the discovery of CRISPR/CAS-9, in the biography The Code Breaker: Jennifer Doudna, Gene Editing, and the Future of the Human Race.cite-ref-90[90]

Further reading

• citerefbusch-vishniacbuschtietjen2024Busch-Vishniac, Ilene; Busch, Lauren; Tietjen, Jill (2024). "Chapter 50. Emmanuelle Charpentier and Jennifer Doudna". Women in the National Inventors Hall of Fame: The First 50 Years. Springer Nature. ISBN 9783031755255.

References

cite-note-abbott2016-11. citerefabbott2016Abbott, Alison (2016). "The quiet revolutionary: How the co-discovery of CRISPR explosively changed Emmanuelle Charpentier's life". Nature. 532 (7600): 432–434. Bibcode:2016Natur.532..432A. doi:10.1038/532432a. PMID 27121823.
cite-note-22. "The Nobel Prize in Chemistry 2020". NobelPrize.org. Retrieved 7 October 2020.
cite-note-33. "CRISPR discoverer gets own research institute". 19 April 2017. Retrieved 14 December 2018.
cite-note-01-44. "Press release: The Nobel Prize in Chemistry 2020". Nobel Foundation. Retrieved 7 October 2020.
cite-note-nyt-20201007-55. citerefwupeltier2020Wu, Katherine J.; Peltier, Elian (7 October 2020). "Nobel Prize in Chemistry Awarded to 2 Scientists for Work on Genome Editing – Emmanuelle Charpentier and Jennifer A. Doudna developed the Crispr tool, which can alter the DNA of animals, plants and microorganisms with high precision". The New York Times. Retrieved 7 October 2020.
cite-note-auto-66. "Two female CRISPR scientists make history, winning Nobel in chemistry". STAT. 7 October 2020. Retrieved 12 October 2020.
cite-note-public-radio-of-armenia-77. "Nobel laureate Emmanuelle Marie Charpentier reveals Armenian identity". Public Radio of Armenia. 6 September 2022. Archived from the original on 29 October 2022. Retrieved 6 September 2022.
cite-note-mpg-vita-88. "Charpentier, Emmanuelle – Vita". Max Planck Society. Retrieved 3 May 2017.
cite-note-99. citerefdeffke2017Deffke, Uta (7 February 2017). "Emmanuelle Charpentier". www.mpg.de. Retrieved 10 June 2020.
cite-note-abbott-432-1010. citerefabbott2016Abbott, Alison (28 April 2016). "The quiet revolutionary: How the co-discovery of CRISPR explosively changed Emmanuelle Charpentier's life". Nature News. 532 (7600): 432–434. Bibcode:2016Natur.532..432A. doi:10.1038/532432a. PMID 27121823.
cite-note-1111. citerefnovakhenriquescharpentiernormark1999Novak, R.; Henriques, B.; Charpentier, E.; Normark, S.; Tuomanen, E. (1999). "Emergence of vancomycin tolerance in Streptococcus pneumoniae". Nature. 399 (6736): 590–593. Bibcode:1999Natur.399..590N. doi:10.1038/21202. ISSN 1476-4687. PMID 10376600. S2CID 424755.
cite-note-1212. citerefcharpentierlavkeracquistacowin2000Charpentier, Emmanuelle; Lavker, Robert M.; Acquista, Elizabeth; Cowin, Pamela (17 April 2000). "Plakoglobin Suppresses Epithelial Proliferation and Hair Growth in Vivo". Journal of Cell Biology. 149 (2): 503–520. doi:10.1083/jcb.149.2.503. ISSN 0021-9525. PMC 2175163. PMID 10769039.
cite-note-1313. "Skirball Institute of Biomolecular Medicine". NYU Langone Health.
cite-note-1414. citerefmangoldsillerroppenservlaminckx2004Mangold, Monika; Siller, Maria; Roppenser, Bernhard; Vlaminckx, Bart J. M.; Penfound, Tom A.; Klein, Reinhard; Novak, Rodger; Novick, Richard P.; Charpentier, Emmanuelle (2004). "Synthesis of group A streptococcal virulence factors is controlled by a regulatory RNA molecule". Molecular Microbiology. 53 (5): 1515–1527. doi:10.1111/j.1365-2958.2004.04222.x. ISSN 1365-2958. PMID 15387826. S2CID 34811329.
cite-note-mims-1515. "Research Groups". MIMS. Retrieved 10 October 2020.
cite-note-1616. "Home". Helmholtz Centre for Infection Research.
cite-note-1717. "Emmanuelle Charpentier, CRISPR-Cas9, Max Planck Institute for Infection Biology". Max Planck Unit for the Science of Pathogens.
cite-note-1818. CRISPR discoverer get own research institute Retrieved 4 September 2018
cite-note-1919. "Emmanuelle Charpentier – Regulation in Infection Biology – Funding". Molecular Infection Medicine Sweden (MIMS). Archived from the original on 4 March 2016. Retrieved 3 January 2016.
cite-note-nature-2020. citerefdeltchevachylinskisharmagonzales2011Deltcheva, Elitza; Chylinski, Krzysztof; Sharma, Cynthia M.; Gonzales, Karine; Chao, Yanjie; Pirzada, Zaid A.; Eckert, Maria R.; Vogel, Jörg; Charpentier, Emmanuelle (March 2011). "CRISPR RNA maturation by trans -encoded small RNA and host factor RNase III". Nature. 471 (7340): 602–607. Bibcode:2011Natur.471..602D. doi:10.1038/nature09886. ISSN 1476-4687. PMC 3070239. PMID 21455174.
cite-note-2121. "CRISPR Therapeutics, About us". Archived from the original on 29 June 2015. Retrieved 15 June 2015.
cite-note-science-2222. citerefjinekchylinskifonfarahauer2012Jinek, Martin; Chylinski, Krzysztof; Fonfara, Ines; Hauer, Michael; Doudna, Jennifer A.; Charpentier, Emmanuelle (17 August 2012). "A Programmable Dual-RNA–Guided DNA Endonuclease in Adaptive Bacterial Immunity". Science. 337 (6096): 816–821. Bibcode:2012Sci...337..816J. doi:10.1126/science.1225829. ISSN 0036-8075. PMC 6286148. PMID 22745249.
cite-note-2323. citerefcohen2017Cohen, Jon (15 February 2017). "How the battle lines over CRISPR were drawn". Science | AAAS. Retrieved 10 June 2020.
cite-note-2424. citerefking2015King, Mary-Claire (16 April 2015). "Emmanuelle Charpentier & Jennifer Doudna". Time. Retrieved 30 August 2022.
cite-note-2525. "Emmanuelle Charpentier named in Time magazine's '100 most influential people in world' list". Umeå University. 13 April 2015. Archived from the original on 11 August 2018. Retrieved 15 June 2015.
cite-note-2626. "The Nobel Prize in Chemistry 2020". NobelPrize.org. Retrieved 10 August 2022.
cite-note-2727. "Emmanuelle Charpentier – Frontiers of Knowledge Laureate". BBVA. Retrieved 10 September 2022.
cite-note-2828. citerefwien2020Wien, Arbeiterkammer (4 May 2020). "Theodor Körner Fonds > 2009 > Ausgezeichnete Arbeiten". www.theodorkoernerfonds.at. Archived from the original on 3 October 2017. Retrieved 3 October 2017.
cite-note-2929. "Eric K. Fernström's Prize to Emmanuelle Charpentier". Molecular Infection Medicine Sweden. 9 June 2011. Retrieved 15 June 2015.
cite-note-3030. "Alexander von Humboldt sponsorship". Humboldt Foundation. Archived from the original on 16 August 2017. Retrieved 15 August 2017.
cite-note-3131. "Göran Gustafsson Prize for Emmanuelle Charpentier". Molecular Infection Medicine Sweden. Retrieved 15 June 2015.
cite-note-3232. "MIMS group leader Emmanuelle Charpentier receives Dr. Paul Janssen Award for discoveries of CRISPR-Cas9". Molecular Infection Medicine Sweden. Retrieved 15 June 2015.
cite-note-3333. "Emmanuelle Charpentier receives Jacob Heskel Gabbay Award". Umeå University. Archived from the original on 25 August 2017. Retrieved 15 June 2015.
cite-note-3434. citerefmary-claire-king2015Mary-Claire King (15 April 2015). "Emmanuelle Charpentier & Jennifer Doudna". Time. Archived from the original on 9 August 2018. Retrieved 17 April 2015.
cite-note-3535. "Umeå University, press release: Emmanuelle Charpentier honored with Breakthrough Prize in Life Sciences". Umeå University. 10 November 2014. Archived from the original on 25 August 2017. Retrieved 15 June 2015. (shared with Jennifer Doudna)
cite-note-3636. "Foundation Louis-Jeanet: "The 2015 Louis-Jeantet Prize-Winners"". Retrieved 19 April 2015.
cite-note-3737. "Laureates 2015 – Professor Emmanuelle Charpentier". Jung-Stiftung für Wissenschaft und Forschung. May 2015. Archived from the original on 25 September 2015. Retrieved 5 June 2015.
cite-note-3838. "Zwei Humboldtianer erhalten Prinzessin-von-Asturien-Preise 2015". humboldt-professur.de. Bonn: Alexander von Humboldt-Stiftung. 29 May 2015. Archived from the original on 20 June 2020. Retrieved 18 June 2020.
cite-note-3939. "YaleNews: Gruber Foundation honors excellence in neuroscience, cosmology, and genetics". Yale University. 16 June 2015. Retrieved 17 June 2015.
cite-note-4040. "Emmanuelle Charpentier receives Carus Medal". Helmholtz-Zentrum für Infektionsforschung | Helmholtz Centre for Infection Research. Helmholtz Centre for Infection research. 7 September 2015. Retrieved 8 September 2015.
cite-note-4141. "Massry winners helped launch gene editing revolution". 7 October 2015. Retrieved 12 January 2018.
cite-note-4242. "Winner of the 2015 Bayer Family Hansen Award". Retrieved 15 December 2021.
cite-note-4343. "MIMS – Curriculum Vitae Emmanuelle Charpentier". www.mims.umu.se. Archived from the original on 1 November 2015. Retrieved 12 January 2018.
cite-note-4444. "France celebrates Emmanuelle Charpentier during the L'Oreal-UNESCO week in Paris". mims.umu.se. Molecular Infection Medicine Sweden. 24 March 2016. Retrieved 20 November 2017.
cite-note-leibnizprize2016-4545. "Leibniz Prizes 2016: DFG Honours Ten Researchers". Deutsche Forschungsgemeinschaft. 10 December 2015. Archived from the original on 30 August 2019. Retrieved 3 January 2016.
cite-note-4646. "Canada Gairdner International Award". Archived from the original on 29 March 2016. Retrieved 25 March 2016.
cite-note-4747. "Paul Ehrlich and Ludwig Darmstaedter Prize 2016".
cite-note-4848. "Tang Prize – Laureates". www.tang-prize.org. Retrieved 12 January 2018.
cite-note-4949. "The 2016 HFSP Nakasone Award goes to Emmanuelle Charpentier & Jennifer Doudna". Human Frontier Science Programme. Archived from the original on 27 September 2018. Retrieved 9 September 2016.
cite-note-5050. "Décret du 31 décembre 2015 portant promotion et nomination – Légifrance".
cite-note-5151. "Die Preisträger". meyenburg-stiftung.de. Heidelberg: Meyenburg-Stiftung. 2018. Retrieved 18 June 2020.
cite-note-5252. "Wilhelm-Exner-Medaille". www.wilhelmexner.org. Archived from the original on 1 August 2017. Retrieved 12 January 2018.
cite-note-5353. "John Scott Award Recipients 2001–2011". www.garfield.library.upenn.edu.
cite-note-5454. "Laureates". Premios Fronteras.
cite-note-5555. "The Japan Prize Foundation". www.japanprize.jp. Retrieved 12 January 2018.
cite-note-5656. "Gene Editing Pioneers Receive Americas Most Distinguished Prize in Medicine". www.amc.edu. Retrieved 12 January 2018.
cite-note-5757. "Pour le Mérite: Emmanuelle Charpentier" (PDF). www.orden-pourlemerite.de. 2017. Archived from the original (PDF) on 7 October 2020. Retrieved 18 June 2020.
cite-note-www-kavliprize-org-2018-5858. "2018 Kavli Prize in Nanoscience". www.kavliprize.org. 22 May 2018. Retrieved 13 December 2021.
cite-note-5959. "Ehrenzeichen für Geografin Leitner und Molekularbiologin Charpentier". Der Standard.
cite-note-6060. "Bijvoet Medal". Bijvoet Center for Biomolecular Research. Archived from the original on 12 September 2017. Retrieved 24 April 2018.
cite-note-6161. Harvey Prize 2018
cite-note-6262. "2019 års Scheelepris till Emmanuelle Charpentier". 1 February 2019. Archived from the original on 31 July 2020. Retrieved 15 July 2019.
cite-note-der-bundespr-sident-6363. "Artikel: Bekanntgabe vom 1. Oktober 2019". Der Bundespräsident (in German). Retrieved 11 February 2023.
cite-note-6464. "The Wolf Prize".
cite-note-6565. "Golden Plate Awardees of the American Academy of Achievement". achievement.org. American Academy of Achievement.
cite-note-bourquenoud-2016-g938-6666. citerefbourquenoud2016Bourquenoud, Sarah (1 October 2016). "L'EPFL fête ses nouveaux diplômés". EPFL (in French). Retrieved 2 December 2023.
cite-note-6767. "Patron Saint's Day 2016: KU Leuven awards 5 honorary degrees". soc.kuleuven.be. Archived from the original on 3 October 2017. Retrieved 17 June 2020.
cite-note-6868. "Darren Walker, Ford Foundation President, to Speak at NYU's Commencement". nyu.edu.
cite-note-6969. "MIMS – Internationally renowned researchers become 2017 honorary doctors at the Faculty of Medicine". www.mims.umu.se.
cite-note-7070. "Charpentier: Be open to new perspectives". westernu.ca. 25 October 2017.
cite-note-7171. HKUST Holds 25th Congregation Conferring Honorary Doctorates on Four Distinguished Academics and Community Leaders, retrieved 20 November 2017
cite-note-7272. "Doctor honoris causa and ISV 20th anniversary". Archived from the original on 23 April 2018. Retrieved 23 April 2018.
cite-note-7373. "Darwin hosts Professor Emmanuelle Charpentier | www.darwin.cam.ac.uk". www.darwin.cam.ac.uk. Archived from the original on 1 February 2020. Retrieved 18 June 2020.
cite-note-7474. "Businessman, scientists, actor and architect honoured as University marks its Foundation Day". manchester.ac.uk.
cite-note-7575. "McGill's Honorary Degree recipients for Spring Convocation 2019". mcgill.ca. Montreal: McGill University. 16 April 2019. Retrieved 18 June 2020.
cite-note-7676. "Dottorato Honoris Causa - Emmanuelle Charpentier". Department of Chemistry, Biology and Biotechnology. 8 November 2024. Retrieved 5 December 2024.
cite-note-find-people-in-the-embo-communities-w845-7777. "Find people in the EMBO Communities". Find people in the EMBO Communities. Retrieved 2 December 2023.
cite-note-nachrichten-aus-der-wissenschaft-idw-2014-k381-7878. "Emmanuelle Charpentier wird EMBO-Mitglied". Nachrichten aus der Wissenschaft » idw (in German). 8 May 2014. Retrieved 2 December 2023.
cite-note-7979. "List of Members". www.leopoldina.org. Archived from the original on 4 October 2017. Retrieved 12 January 2018.
cite-note-8080. "Mitglied Emmanuelle Charpentier". bbaw.de. Berlin: Berlin-Brandenburgische Akademie der Wissenschaften. 2020. Retrieved 18 June 2020.
cite-note-8181. "ÖAW wählte 26 neue Mitglieder". Archived from the original on 3 October 2017. Retrieved 12 January 2018.
cite-note-8282. "Kungl. Vetenskapsakademien". www.kva.se. 19 November 2015. Retrieved 12 January 2018.
cite-note-8383. "National Academy of Sciences Members and Foreign Associates Elected". National Academy of Sciences. 2 May 2017. Retrieved 12 May 2017.
cite-note-8484. "12 New Members Elected in 2016 to the National Academy Fo Technologies of France (NATF)". www.academie-technologies.fr. Archived from the original on 11 October 2020. Retrieved 17 June 2020.
cite-note-8585. Dix-huit nouveaux membres élus à l'Académie des sciences. Press release issued 6 December 2017, retrieved on 28 February 2018.
cite-note-european-academy-of-sciences-and-arts-8686. "News". European Academy of Sciences and Arts. Retrieved 7 October 2020.
cite-note-8787. citerefdulle2021Dulle, Colleen (13 August 2021). "Pope Francis appointed three women to the Pontifical Academy of Sciences this summer. What's their role at the Vatican?". America. Retrieved 15 October 2021.
cite-note-8888. "Professor Emmanuelle Charpentier ForMemRS". Royal Society. Retrieved 20 May 2024.
cite-note-8989. citerefreinckensReinckens, Mina. "'STEM FEMMES' centers women in science with theater". Broad Street Review. Retrieved 24 February 2021.
cite-note-9090. citerefisaacson2021Isaacson, Walter (2021). The code breaker : Jennifer Doudna, gene editing, and the future of the human race (First hardcover ed.). New York: Simon & Schuster. ISBN 978-1-9821-1585-2. OCLC 1187220557.

External links

Wikimedia Commons has media related to

Emmanuelle Charpentier

.

• Official website
• Extensive biography of Emmanuelle Charpentier Archived 12 February 2021 at the Wayback Machine at the Max Planck Unit for the Science of Pathogens
• Umeå University Staff Directory: Emmanuelle Charpentier
• Molecular Infection Medicine Sweden – Short Curriculum Vitae of Emmanuelle Charpentier
• Crispr Therapeutics: Scientific Founders
• Emmanuelle Charpentier to become a Director at the Max Planck Institute for Infection Biology in Berlin
• Emmanuelle Charpentier on Nobelprize.org